PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_4747.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 354aa    MW: 39306.9 Da    PI: 6.5083
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_4747.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1676.3e-52151421128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeel+v+yL +++++ + ++  +i+ev+iyk++PwdLp k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++ls+  +
  MLOC_4747.1  15 LPPGFRFHPTDEELIVHYLGRQAASMPSPV-PIIAEVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKAILSTpAN 111
                  79*************************999.88***************8777899**************************************99888 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  e +g+kk Lvfy+g+ pkg+ktdW+mheyrl
  MLOC_4747.1 112 ESIGVKKALVFYRGKPPKGVKTDWIMHEYRL 142
                  99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.1E-645170IPR003441NAC domain
PROSITE profilePS5100560.62915170IPR003441NAC domain
PfamPF023653.0E-2616142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MPMGSSSSSA AMPALPPGFR FHPTDEELIV HYLGRQAASM PSPVPIIAEV NIYKCNPWDL  60
PGKALFGENE WYFFSPRDRK YPNGARPNRA AGSGYWKATG TDKAILSTPA NESIGVKKAL  120
VFYRGKPPKG VKTDWIMHEY RLTAADNRAT KRRGSSMRLD DWVLCRIHKK CGNLPNFSSD  180
QEQEHEQESS TVEDSHNNHT VSSPKSEAFD GDGDGDDQLQ LQQFRPMAIA KSCSLTDLLN  240
TVDYAALSHL LLDGSAGAGA SSSDAGLDYQ LPPENPLIYS QPPWQQTLHY NNNNNGYVNH  300
DTIDVPQLTE ARLDDYGMKR KRSSGSLYCS QLQVPADQYS GMLIHPFLSQ QLHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-7411701168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197650.0FR819765.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC027 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615093.11e-128PREDICTED: NAC transcription factor 29
SwissprotO492557e-84NAC29_ARATH; NAC transcription factor 29
SwissprotA0SPJ62e-83NAMB2_TRITD; NAC transcription factor NAM-B2
TrEMBLM0WBD20.0M0WBD2_HORVD; Uncharacterized protein
STRINGMLOC_4747.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38033775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.17e-78NAC domain containing protein 2